OCA2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to OCA2(oculocutaneous albinism II) The peptide sequence was selected from the middle region of OCA2. Peptide sequence LIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGIC.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
OCA2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against OCA2 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
93 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for OCA2 Antibody
- BEY
- BEY1
- BEY2
- D15S12BOCA
- EYCL
- EYCL2
- eye color 2 (central brown)
- eye color 3 (brown)
- hair color 3 (brown)
- HCL3
- Melanocyte-specific transporter protein
- oculocutaneous albinism II (pink-eye dilution (murine) homolog)
- oculocutaneous albinism II (pink-eye dilution homolog, mouse)
- oculocutaneous albinism II
- P protein
- PED
- PEYCL3
- Pink-eyed dilution protein homolog
- SHEP1
- total brown iris pigmentation
Background
OCA2 is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine – a precursor of melanin. Mutations in the gene encoding OCA2 result in type 2 oculocutaneous albinism.This gene encodes the human homologue of the mouse p (pink-eyed dilution) gene. The encoded protein is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine – a precursor of melanin. Mutations in this gene result in type 2 oculocutaneous albinism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.