OSTalpha Antibody Summary
| Immunogen |
Synthetic peptides corresponding to OSTalpha (organic solute transporter alpha) The peptide sequence was selected from the middle region of OSTalpha.Peptide sequence LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS.
|
| Specificity |
This product is specific to Subunit or Isofrom: alpha.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SLC51A
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This is a rabbit polyclonal antibody against OSTalpha and was validated on Western blot.
|
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for OSTalpha Antibody
- MGC39807
- organic solute transporter alpha
- organic solute transporter subunit alpha
- OSTA
- OST-alpha
Background
OSTalpha is essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood.OSTalpha efficiently transports the major species of bile acids.