PATJ Antibody Summary
| Immunogen |
Synthetic peptides corresponding to INADL(InaD-like (Drosophila)) The peptide sequence was selected from the N terminal of INADL.Peptide sequence EVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSG.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
INADL
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against INADL and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for PATJ Antibody
- channel-interacting PDZ domain protein
- FLJ26982
- hINADL
- inactivation no after-potential D-like protein
- Inadl protein
- InaD-like (Drosophila)
- inaD-like protein
- InaD-like
- Pals1-associated tight junction protein
- PATJCipp
- PDZ domain protein
- Protein associated to tight junctions
Background
INADL is a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors.This gene encodes a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.