PCPE-1/PCOLCE Antibody Summary
| Immunogen |
Synthetic peptides corresponding to PCOLCE(procollagen C-endopeptidase enhancer) The peptide sequence was selected from the middle region of PCOLCE (NP_002584). Peptide sequence LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PCOLCE
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
|
| Theoretical MW |
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Concentration |
LYOPH
|
| Purity |
Immunogen affinity purified
|
| Reconstitution Instructions |
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for PCPE-1/PCOLCE Antibody
- PCOLCE
- PCPE
- PCPE1
- PCPE-1
- PCPE1Type I procollagen COOH-terminal proteinase enhancer
- procollagen C-endopeptidase enhancer 1
- procollagen C-endopeptidase enhancer
- Procollagen COOH-terminal proteinase enhancer 1
- Procollagen C-proteinase enhancer 1
- procollagen, type 1, COOH-terminal proteinase enhancer
- Type 1 procollagen C-proteinase enhancer protein
Background
PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.