PNCK Antibody Summary
| Immunogen |
The immunogen for this antibody is Pnck – C-terminal region. Peptide sequence QKNFARTHWKRAFNATSFLRHIRKLGQSPEGEEASRQGMTRHSHPGLGTS.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PNCK
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for PNCK Antibody
- BSTK3
- calcium/calmodulin-dependent protein kinase type 1B
- CaM kinase I beta
- CaM kinase IB
- CaMK1b
- CaM-KI beta
- caMKI-beta
- EC 2.7.11
- EC 2.7.11.17
- FLJ50403
- FLJ50549
- FLJ56451
- FLJ59811
- MGC45419
- pregnancy up-regulated non-ubiquitously expressed CaM kinase
- pregnancy upregulated non-ubiquitously expressed CaM kinase
- Pregnancy up-regulated non-ubiquitously-expressed CaM kinase
Background
Pnck contains alternatively spliced isoforms CaM kinase Ibeta3 and Ibeta1; both isoforms activate CaM kinase Ialpha activity via Thr177 phosphorylation.