POLE4 Antibody Summary
| Immunogen |
Synthetic peptide directed towards the N terminal of human POLE4. Peptide sequence MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALV.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
POLE4
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against POLE4 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for POLE4 Antibody
- DNA polymerase epsilon p12 subunit
- DNA polymerase epsilon subunit 4
- DNA polymerase epsilon subunit p12
- DNA polymerase II subunit 4
- EC 2.7.7.7
- p12
- polymerase (DNA-directed), epsilon 4 (p12 subunit)
- YHHQ1