POLR2K Antibody Summary
| Immunogen |
Synthetic peptides corresponding to POLR2K(polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa) The peptide sequence was selected from the middle region of POLR2K (NP_005025).Peptide sequence DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR.
|
| Specificity |
This product is specific to Subunit or Isofrom: RPABC4.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
POLR2K
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This is a rabbit polyclonal antibody against POLR2K and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Theoretical MW |
7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for POLR2K Antibody
- ABC10-alpha
- DNA directed RNA polymerases I, II, and III 7.0 kda polypeptide
- DNA-directed RNA polymerase II subunit K
- DNA-directed RNA polymerases I, II, and III subunit RPABC4
- hRPB7.0
- hsRPB10a
- polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa
- RNA polymerase II 7.0 kDa subunit
- RNA polymerases I, II, and III subunit ABC4
- RPABC4
- RPB10alphapolymerase (RNA) II (DNA directed) polypeptide K (7.0kD)
- RPB12
- RPB7.0
Background
POLR2K is one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases.This gene encodes one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.