POLR3F Antibody Summary
| Immunogen |
Synthetic peptides corresponding to POLR3F(polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa) The peptide sequence was selected from the middle region of POLR3F.Peptide sequence LNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVE.
|
| Specificity |
This product is specific to Subunit or Isofrom: RPC6.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
POLR3F
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against POLR3F and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for POLR3F Antibody
- DNA-directed RNA polymerase III 39 kDa polypeptide
- DNA-directed RNA polymerase III subunit F
- DNA-directed RNA polymerase III subunit RPC6
- DNA-directed RNA polymerases III 39 kDa polypeptide
- polymerase (RNA) III (DNA directed) polypeptide F (39 kDa)
- polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa
- RNA polymerase III 39 kDa subunit
- RNA polymerase III C39 subunit
- RNA polymerase III subunit C6
- RPC39MGC13517
- RPC6
Background
POLR3F is one of more than a dozen subunits forming eukaryotic RNA polymerase III (RNA Pol III), which transcribes 5S ribosomal RNA and tRNA genes. This protein has been shown to bind both TFIIIB90 and TBP, two subunits of RNA polymerase III transcription initiation factor IIIB (TFIIIB). Unlike most of the other RNA Pol III subunits, the encoded protein is unique to this polymerase.The protein encoded by this gene is one of more than a dozen subunits forming eukaryotic RNA polymerase III (RNA Pol III), which transcribes 5S ribosomal RNA and tRNA genes. This protein has been shown to bind both TFIIIB90 and TBP, two subunits of RNA polymerase III transcription initiation factor IIIB (TFIIIB). Unlike most of the other RNA Pol III subunits, the encoded protein is unique to this polymerase.