PPP1R3A Antibody Summary
| Immunogen |
Synthetic peptides corresponding to PPP1R3A(protein phosphatase 1, regulatory (inhibitor) subunit 3A) The peptide sequence was selected from the N terminal of PPP1R3A. Peptide sequence MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSE.
|
| Specificity |
This product is specific to Subunit or Isofrom: 3A.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PPP1R3A
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against PPP1R3A and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
126 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for PPP1R3A Antibody
- glycogen and sarcoplasmic reticulum binding subunit, skeletal muscle
- GM
- PP1G
- PPP1R3
- protein phosphatase 1 glycogen- associated regulatory subunit
- Protein phosphatase 1 glycogen-associated regulatory subunit
- protein phosphatase 1 regulatory subunit 3A
- protein phosphatase 1, regulatory (inhibitor) subunit 3A (glycogen andsarcoplasmic reticulum binding subunit, skeletal muscle)
- protein phosphatase 1, regulatory (inhibitor) subunit 3A
- Protein phosphatase type-1 glycogen targeting subunit
- RG1
- serine /threonine specific protein phosphatase
- type-1 protein phosphatase skeletal muscle glycogen targeting subunit
Background
The glycogen-associated form of protein phosphatase-1 (PP1) derived from skeletal muscle is a heterodimer composed of a 37-kD catalytic subunit and a 124-kD targeting and regulatory subunit. This gene encodes the regulatory subunit which binds to muscle g