PSG5 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to PSG5(pregnancy specific beta-1-glycoprotein 5) The peptide sequence was selected from the middle region of PSG5.Peptide sequence SIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PSG5
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against PSG5 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for PSG5 Antibody
- Fetal liver non-specific cross-reactive antigen 3
- FL-NCA-3PSG
- pregnancy specific beta-1-glycoprotein 5
- pregnancy-specific beta 1 glycoprotein
- pregnancy-specific beta-1 glycoprotein
- pregnancy-specific beta-1-glycoprotein 5
- Pregnancy-specific beta-1-glycoprotein-5
- Pregnancy-specific glycoprotein 5
- PS-beta-G-5
- PSBG-5
Background
The pregnancy-specific beta 1 glycoprotein (PSG) is a group of heterogeneous proteins produced in large amounts by the human syncytiotrophoblast. They belong to the carcinoembryonic antigen (CEA) family. The function of PSG5 remains unknown.