PSG9 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to PSG9(pregnancy specific beta-1-glycoprotein 9) The peptide sequence was selected from the N terminal of PSG9.Peptide sequence YSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYI.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PSG9
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against PSG9 and was validated on Western Blot and immunohistochemistry-paraffin
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for PSG9 Antibody
- pregnancy specific beta-1-glycoprotein 9
- Pregnancy-specific beta-1 glycoprotein B
- Pregnancy-specific beta-1-glycoprotein 11
- pregnancy-specific beta-1-glycoprotein 9
- Pregnancy-specific glycoprotein 11
- Pregnancy-specific glycoprotein 7
- Pregnancy-specific glycoprotein 9
- PS34
- PS-beta-B
- PS-beta-G-11
- PS-beta-G-9
- PSBG-11
- PSBG-9
- PSG11pregnancy specific beta-1-glycoprotein 11
- PSG7
- PSGII
Background
The function remains unknown.