PSG-1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to PSG1(pregnancy specific beta-1-glycoprotein 1) The peptide sequence was selected from the C terminal of PSG1. Peptide sequence YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSA.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PSG1
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This is a rabbit polyclonal antibody against PSG1 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Theoretical MW |
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for PSG-1 Antibody
- B1G1
- B1G1CD66 antigen-like family member F
- CD66f antigen
- CD66f
- DHFRP2
- Fetal liver non-specific cross-reactive antigen 1/2
- FLJ90598
- FLJ90654
- FL-NCA-1/2
- PBG1
- pregnancy specific beta-1-glycoprotein 1
- pregnancy-specific B-1 glycoprotein
- Pregnancy-specific beta-1 glycoprotein C/D
- pregnancy-specific beta-1-glycoprotein 1
- Pregnancy-specific glycoprotein 1
- PS-beta-C/D
- PS-beta-G-1
- PSbG1
- PSBG-1
- PSBG1SP1
- PSG1
- PSG-1
- PSG95
- PSGGA
- PSGGAPSG95
- PSGIIA
Background
The function remains unknown.