Peroxiredoxin 6 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to PRDX6(peroxiredoxin 6) The peptide sequence was selected from the middle region of PRDX6 (NP_004896).Peptide sequence ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PRDX6
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
|
| Theoretical MW |
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Peroxiredoxin 6 Antibody
- 1-Cys
- 24 kDa protein
- Acidic calcium-independent phospholipase A2
- aiPLA2
- aiPLA21-Cys PRX
- Antioxidant protein 2
- AOP2
- AOP2Non-selenium glutathione peroxidase
- EC 1.11.1.15
- EC 1.11.1.7
- EC 3.1.1.-
- KIAA0106Red blood cells page spot 12
- Liver 2D page spot 40
- MGC46173
- NSGPx
- NSGPx1-Cys peroxiredoxin
- p29
- Peroxiredoxin 6
- peroxiredoxin-6
- PRDX6
- PRX
Background
PRDX6 is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.