RAPGEF3 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to RAPGEF3 (Rap guanine nucleotide exchange factor (GEF) 3) The peptide sequence was selected from the middle region of RAPGEF3.Peptide sequence HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
RAPGEF3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against RAPGEF3 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for RAPGEF3 Antibody
- 9330170P05Rik
- bcm910
- cAMP-GEFI
- cAMP-regulated guanine nucleotide exchange factor I
- CGEF1
- EPAC 1
- EPAC1
- EPACRAP guanine-nucleotide-exchange factor (GEF) 3
- Exchange factor directly activated by cAMP 1
- Exchange protein directly activated by cAMP 1
- HSU79275
- MGC21410
- Rap guanine nucleotide exchange factor (GEF) 3
- rap guanine nucleotide exchange factor 3
- Rap1 guanine-nucleotide-exchange factor directly activated by cAMP
Background
The function of the protein remains unknown.