RBM42 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to RBM42 (RNA binding motif protein 42) The peptide sequence was selected from the middle region of RBM42)(50ug).Peptide sequence RPRPPRPEPPPGLMALEVPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPS.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
RBM42
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against RBM42 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for RBM42 Antibody
- MGC10433
- RNA binding motif protein 42
- RNA-binding motif protein 42
- RNA-binding protein 42
Background
RBM42 belongs to the RRM RBM42 family and it contains 1 RRM (RNA recognition motif) domain. The functions of RBM42 remain unknown.