REEP1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to REEP1(receptor accessory protein 1) The peptide sequence was selected from the C terminal of REEP1.Peptide sequence ERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESA.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
REEP1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against REEP1 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for REEP1 Antibody
- C2orf23
- chromosome 2 open reading frame 23
- receptor accessory protein 1
- receptor expression-enhancing protein 1
- SPG31FLJ13110
Background
REEP1 belongs to the DP1 family and may enhance the cell surface expression of odorant receptors.