RGS19 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to RGS19(regulator of G-protein signaling 19) The peptide sequence was selected from the N terminal of RGS19.Peptide sequence PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSW.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
RGS19
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against RGS19 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for RGS19 Antibody
- G alpha interacting protein
- GAIPG protein signalling regulator 19
- G-alpha-interacting protein
- GNAI3IP
- guanine nucleotide binding protein alpha inhibiting activity polypeptide 3interacting protein
- regulator of G-protein signaling 19
- regulator of G-protein signalling 19
- RGSGAIP
Background
G proteins mediate a number of cellular processes. RGS19 belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling.G proteins mediate a number of cellular processes. The protein encoded by this gene belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling. Alternatively spliced transcript variants encoding the same protein isoform have been found for this gene.