Product: Eflornithine (hydrochloride, hydrate)
RPA4 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to RPA4(replication protein A4, 34kDa) The peptide sequence was selected from the middle region of RPA4.Peptide sequence VPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCD.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
RPA4
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against RPA4 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for RPA4 Antibody
- HSU24186
- MGC120333
- MGC120334
- Replication factor A protein 4
- replication protein A 30 kDa subunit
- replication protein A complex 34 kd subunit homolog Rpa4
- replication protein A4, 30kDa
- replication protein A4, 34kDa
- RF-A protein 4
- RP-A p30
Background
Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. RPA4 is the 32-kDa subunit of the RPA, which associates with the 70- and 13-kDa subunits to form a trimeric RPA complex. Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. This gene encodes the 32-kDa subunit of the RPA, which associates with the 70- and 13-kDa subunits to form a trimeric RPA complex. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1448 BC069824.1 1-1448