Product: Tiapride (hydrochloride)
Recombinant Human GM-CSF Protein Summary
| Description |
A recombinant protein to GM-CSF.
Amino Acid Sequence: MAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE |
| Preparation Method |
E.coli
|
| Details of Functionality |
The ED50 for this effect is < 0.18 ng/ml. Measured in a cell proliferation assay using TF1 human erythroleukemic cells.
|
| Protein/Peptide Type |
Recombinant Protein
|
| Gene |
CSF2
|
| Purity |
>95% pure by SDS-PAGE
|
| Endotoxin Note |
< 1.0 EU per 1 microgram of protein (determined by LAL method)
|
Applications/Dilutions
| Application Notes |
The purity of this protein is > 95% by SDS-PAGE. Molecular weight is 14.6 kDa (128 aa), confirmed by MALDI-TOF.
Assay |
| Theoretical MW |
14.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles.
|
| Buffer |
Phosphate-buffered saline (pH 7.4)
|
| Preservative |
No Preservative
|
| Concentration |
1.0 mg/ml
|
| Purity |
>95% pure by SDS-PAGE
|
Alternate Names for Recombinant Human GM-CSF Protein
- colony stimulating factor 2 (granulocyte-macrophage)
- Colony-stimulating factor
- CSF
- CSF2
- GMCSF
- GM-CSF
- GMCSFgranulocyte-macrophage colony-stimulating factor
- granulocyte-macrophage colony stimulating factor
- MGC131935
- MGC138897
- molgramostin
- sargramostim
Background
Human GM-CSF is a 14.6 kDa globular protein consisting of 128 amino acid containing two dislufied bonds. GM-CSF is a hematopoietic growth factor that stimulates the development of neutrophils and macrophages and promotes the proliferation and development of early erythroid megakaryocytic and eosinophilic progenitor cells. It is produced in by endothelial cells, monocytes, fibroblasts and T-lymphocytes. GM-CSF inhibits neutrophil migration and enhances the functional activity of the mature end-cells. Recombinant human GM-CSF was expressed in E.coli and purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.