Recombinant Human KChIP2 Protein Summary
| Description |
KChIP2 (Human) GST-Tagged Recombinant Protein
Source: Wheat Germ (in vitro) Amino Acid Sequence: MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSETLAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVI |
| Preparation Method |
in vitro wheat germ expression system
|
| Details of Functionality |
This protein is not active and should not be used for experiments requiring activity.
|
| Protein/Peptide Type |
Recombinant Protein
|
| Gene |
KCNIP2
|
Applications/Dilutions
| Application Notes |
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
|
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles.
|
| Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
|
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human KChIP2 Protein
- A-type potassium channel modulatory protein 2
- cardiac voltage gated potassium channel modulatory subunit
- Cardiac voltage-gated potassium channel modulatory subunit
- DKFZp566L1246
- KChIP2
- KCHIP2Kv channel-interacting protein 2
- Kv channel interacting protein 2
- MGC17241
- potassium channel interacting protein 2
- Potassium channel-interacting protein 2
Background
This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene. [provided by RefSeq]