Rhot1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to RHOT1(ras homolog gene family, member T1) The peptide sequence was selected from the middle region of RHOT1.Peptide sequence ASAVTVTRDKKIDLQKKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMR.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
RHOT1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against RHOT1 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Rhot1 Antibody
- ARHT1
- EC 3.6.5
- EC 3.6.5.-
- FLJ11040
- FLJ12633
- hMiro-1
- Miro1
- MIRO-1mitochondrial Rho GTPase 1
- mitochondrial Rho 1
- rac-GTP binding protein-like protein
- Rac-GTP-binding protein-like protein
- Ras homolog gene family member T1
- ras homolog gene family, member T1
- Rhot1
Background
Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.