Product: Genz-123346 (free base)
SC5DL Antibody Summary
| Immunogen |
Synthetic peptides corresponding to SC5DL(sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, S. cerevisiae)-like) The peptide sequence was selected from the N terminal of SC5DL.Peptide sequence NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SC5DL
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against SC5DL and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for SC5DL Antibody
- 3beta-hydroxysteroid-delta5-desaturase
- C-5 sterol desaturase
- Delta(7)-sterol 5-desaturase
- EC 1.14.21.6
- ERG3
- fungal ERG3, delta-5-desaturase-like
- Lathosterol 5-desaturase
- lathosterol dehydrogenase
- lathosterol oxidase
- S5DES
- SC5D
- sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, fungal)-like
- sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, S. cerevisiae)-like
- sterol-C5-desaturase (fungal ERG3, delta-5-desaturase)-like
- Sterol-C5-desaturase
Background
SC5DL catalyzes a dehydrogenation to introduce C5-6 double bond into lathosterol.This gene encodes an enzyme of cholesterol biosynthesis. The encoded protein catalyzes the conversion of lathosterol into 7-dehydrocholesterol. Mutations in this gene have been associated with lathosterolosis. Alternatively spliced transcript variants encoding the same protein have been described.