SDC3 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to the N terminal of Sdc3. Immunizing peptide sequence GLLLPPLLLLLLAGRAAGAQRWRNENFERPVDLEGSGDDDSFPDDELDDL.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SDC3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against Sdc3 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for SDC3 Antibody
- KIAA0468
- N-Syndecan
- SDC3
- SDCN
- SYND3syndecan proteoglycan 3
- syndecan 3 (N-syndecan)
- syndecan 3
- syndecan neural type
- Syndecan3
- Syndecan-3
Background
Sdc3 is a cell surface proteoglycan that may bear heparan sulfate. It may have a role in the organization of cell shape by affecting the actin cytoskeleton, possibly by transferring signals from the cell surface in a sugar-dependent mechanism.