SLCO3A1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to SLCO3A1(solute carrier organic anion transporter family, member 3A1) The peptide sequence was selected from the middle region of SLCO3A1 (NP_037404).Peptide sequence MEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SLCO3A1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for SLCO3A1 Antibody
- FLJ40478
- OATP3A1OATP-RP3
- OATP-DOATPRP3
- OATPDSLC21A11
- Organic anion transporter polypeptide-related protein 3
- Organic anion-transporting polypeptide D
- PGE1 transporter
- Sodium-independent organic anion transporter D
- solute carrier family 21 (organic anion transporter), member 11
- Solute carrier family 21 member 11
- solute carrier organic anion transporter family member 3A1
- solute carrier organic anion transporter family, member 3A1
Background
SLCO3A1 mediates the Na+-independent transport of organic anions such as estrone-3-sulfate. It mediates transport of prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123 and vasopressin, but not DPDPE (a derivative of enkephalin lacking an N-terminal tyrosine residue), estrone-3-sulfate, taurocholate, digoxin nor DHEAS.