Product: Ro 48-8071 (fumarate)
SPPL3 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to UNQ1887 (signal peptide peptidase 3) The peptide sequence was selected from the middle region of UNQ1887.Peptide sequence VMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHF.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SPPL3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against UNQ1887 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for SPPL3 Antibody
- DKFZp586C1324
- EC 3.4.23.-
- IMP-2
- IMP2MGC126674
- Intramembrane protease 2
- MDHV1887
- MGC126676
- MGC90402
- Presenilin-like protein 4
- PRO4332
- PSL4
- signal peptide peptidase 3
- signal peptide peptidase-like 3
- SPP-like 3
Background
UNQ1887 may act as intramembrane protease.