ST6GALNAC3 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to ST6GALNAC3(ST6-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3) The peptide sequence was selected from the C terminal of ST6GALNAC3. Peptide sequence HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHP
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
ST6GALNAC3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against ST6GALNAC3 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for ST6GALNAC3 Antibody
- alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
- alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase III
- EC 2.4.99.-
- EC 2.4.99.7
- FLJ13669
- FLJ27239
- GalNAc alpha-2,6-sialyltransferase III
- PRO7177
- sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) C
- Sialyltransferase 7C
- SIAT7C
- SIAT7-C
- ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltran
- ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 3
- ST6GalNAc III
- ST6GALNACIII
- STY
Background
ST6GALNAC3 belongs to a family of sialyltransferases that transfer sialic acids from CMP-sialic acid to terminal positions of carbohydrate groups in glycoproteins and glycolipids.ST6GALNAC3 belongs to a family of sialyltransferases that transfer sialic acids from CMP-sialic acid to terminal positions of carbohydrate groups in glycoproteins and glycolipids (Lee et al., 1999 [PubMed 10207017]).[supplied by OMIM].