SYDE1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to SYDE1(synapse defective 1, Rho GTPase, homolog 1 (C. elegans)) The peptide sequence was selected from the N terminal of SYDE1.Peptide sequence PSPPEPEPQAPEGSQAGAEGPSSPEASRSPARGAYLQSLEPSSRRWVLGG.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SYDE1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against SYDE1 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for SYDE1 Antibody
- EC 2.4.1.25
- EC 2.6.1.9
- FLJ13511
- Protein syd-1 homolog 1
- rho GTPase-activating protein SYDE1
- synapse defective 1, Rho GTPase, homolog 1 (C. elegans)
- Synapse defective protein 1 homolog 1,7h3
Background
SYDE1 contains 1 Rho-GAP domain. It is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.