Slit3 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to SLIT3(slit homolog 3 (Drosophila)) The peptide sequence was selected from the N terminal of SLIT3 (NP_003053). Peptide sequence PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SLIT3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against SLIT3 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
168 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Slit3 Antibody
- KIAA0814
- MEGF5
- MEGF5Multiple epidermal growth factor-like domains protein 5
- Multiple EGF-like domains protein 5
- SLIL2
- SLIL2FLJ10764
- slit homolog 3 (Drosophila)
- slit homolog 3 protein
- SLIT1
- slit2
- Slit3
- Slit-3slit (Drosophila) homolog 3
Background
SLIT3 may act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.