TBC1D24 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to TBC1D24(TBC1 domain family, member 24) The peptide sequence was selected from the middle region of TBC1D24.Peptide sequence SDPADRLSPFLAARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDL.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
TBC1D24
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against TBC1D24 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for TBC1D24 Antibody
- KIAA1171FIME
- MGC102885
- TBC1 domain family member 24
- TBC1 domain family, member 24
Background
TBC1D24 may act as a GTPase-activating protein for Rab family protein(s).