Transglutaminase 3/TGM3 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to TGM3(transglutaminase 3 (E polypeptide, protein-glutamine-gamma-glutamyltransferase)) The peptide sequence was selected from the N terminal of TGM3. Peptide sequence MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQN
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
TGM3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against TGM3 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
77 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Transglutaminase 3/TGM3 Antibody
- EC 2.3.2.13
- MGC126250
- protein-glutamine gamma-glutamyltransferase E
- TG(E)
- TG3
- TGase E
- TGase-3
- TgaseE
- TGEMGC126249
- TGM3
- transglutaminase 3 (E polypeptide, protein-glutamine-gamma-glutamyltransferase)
- Transglutaminase 3
- Transglutaminase E
- transglutaminase-3
Background
Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites