Trypsin 3/PRSS3 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to PRSS3 (protease, serine, 3) The peptide sequence was selected from the N terminal of PRSS3.Peptide sequence VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PRSS3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against PRSS3 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Trypsin 3/PRSS3 Antibody
- Brain trypsinogen
- EC 3.4.21
- EC 3.4.21.4
- Mesotrypsin
- mesotrypsinogen
- MTG
- pancreatic trypsinogen III
- protease, serine, 3 (mesotrypsin)
- protease, serine, 3
- protease, serine, 4 (trypsin 4, brain)
- PRSS3
- PRSS4
- Serine protease 3
- Serine protease 4
- T9
- TRY3MTG
- TRY4mesotrypsin
- Trypsin 3
- Trypsin 4
- Trypsin III
- Trypsin IV
- trypsin-3
- Trypsinogen 15
- trypsinogen 4
- trypsinogen 5
- trypsinogen IV
Background
This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is expressed in the brain and pancreas and is resistant to common trypsin inhibitors. It is active on peptide linkages involving the carboxyl group of lysine or arginine. This gene is localized to the locus of T cell receptor beta variable orphans on chromosome 9. Four transcript variants encoding different isoforms have been described for this gene.