UBAC2 Antibody Summary
| Immunogen |
Synthetic peptide directed towards the middle region of human UBAC2. Peptide sequence YCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGL.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
UBAC2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against UBAC2 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for UBAC2 Antibody
- FLJ26351
- FLJ30001
- FLJ42413
- MGC90487
- PHGDHL1
- phosphoglycerate dehydrogenase-like protein 1
- RP11-178C10.1
- UBA domain containing 2
- ubiquitin-associated domain-containing protein 2