UGCG Antibody Summary
| Immunogen |
Synthetic peptides corresponding to UGCG(UDP-glucose ceramide glucosyltransferase) The peptide sequence was selected from the N terminal of human UGCG.Peptide sequence LHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVL.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
UGCG
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against UGCG and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for UGCG Antibody
- ceramide glucosyltransferase
- EC 2.4.1.80
- GCSGLCT1
- GLCT-1
- Glucosylceramide synthase
- UDP-glucose ceramide glucosyltransferaseUDP-glucose:N-acylsphingosine D-glucosyltransferase
Background
Glycosphingolipids (GSLs) are a group of membrane components that contain lipid and sugar moieties. They are present in essentially all animal cells and are believed to have important roles in various cellular processes. UDP-glucose ceramide glucosyltrans