Product: ZLN024 (hydrochloride)
UGT2B15 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to UGT2B15(UDP glucuronosyltransferase 2 family, polypeptide B15) The peptide sequence was selected from the N terminal of UGT2B15. Peptide sequence IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
UGT2B15
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against UGT2B15 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for UGT2B15 Antibody
- EC 2.4.1
- EC 2.4.1.17
- HLUG4
- UDP glucuronosyltransferase 2 family, polypeptide B15
- UDP glycosyltransferase 2 family, polypeptide B15
- UDP glycosyltransferase 2B15
- UDP-glucuronosyltransferase 2B15
- UDP-glucuronosyltransferase 2B8
- UDP-glucuronosyltransferase UGT2B15
- UDP-glucuronyltransferase, family 2, beta-15
- UDPGT 2B15
- UDPGT 2B8
- UDPGTH3
- UDPGTh-3
- UGT2B8UDPGT2B15
Background
The UGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. UGT2B8 demonstrates reactivity with estriol. The UGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. UGT2B8 demonstrates reactivity with estriol. See UGT2B4 (MIM 600067).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1605 AF180322.1 1-1605 1606-1700 U06641.1 1547-1641 1701-1798 U08854.1 1684-1781 1799-1801 U06641.1 1779-1781 1802-1837 U06641.1 1783-1818 1838-1909 U08854.1 1822-1893 1910-2106 AF180322.1 1911-2107 2107-2144 U06641.1 2086-2123