UNC50 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to UNC50(unc-50 homolog (C. elegans)) The peptide sequence was selected from the N terminal of UNC50.Peptide sequence LPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAW.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
UNC50
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against UNC50 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for UNC50 Antibody
- geal-6 membrane-associated high-copy suppressor 1
- GMH1
- hGMH1
- PDLs22
- Periodontal ligament-specific protein 22
- Protein GMH1 homolog
- protein unc-50 homolog
- unc-50 homolog (C. elegans)
- unc-50 related
- UNCLDKFZp564G0222
- Uncoordinated-like protein
- URP
Background
UNC50 belongs to the unc-50 family. It binds RNA. UNC50 may be involved in cell surface expression of neuronal nicotinic receptors.