USP9Y Antibody Summary
| Immunogen |
Synthetic peptide directed towards the C terminal of human USP9YThe immunogen for this antibody is USP9Y. Peptide sequence PHSPASQYQQNNHVHGQPYTGPAAHHLNNPQKTGQRTQENYEGNEEVSSP.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
USP9Y
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against USP9Y and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
291 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for USP9Y Antibody
- Deubiquitinating enzyme FAF-Y
- DFFRYFLJ33043
- EC 3.1.2.15
- EC 3.4.19.12
- Fat facets protein-related, Y-linked
- probable ubiquitin carboxyl-terminal hydrolase FAF-Y
- ubiquitin specific peptidase 9, Y-linked (fat facets-like, Drosophila)
- ubiquitin specific peptidase 9, Y-linked
- ubiquitin thioesterase FAF-Y
- Ubiquitin thiolesterase FAF-Y
- ubiquitin-specific processing protease FAF-Y
- Ubiquitin-specific protease 9, Y chromosome
- Ubiquitin-specific-processing protease FAF-Y