UTP15 Antibody Summary
| Immunogen |
The immunogen for this antibody is Utp15 – middle region. Peptide sequence DETIVVGMTNGILSVKHRKSEAKKTSLPRRRRPAYRTFIKGKNYLKQRDD.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
UTP15
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for UTP15 Antibody
- U3 small nucleolar ribonucleoprotein, homolog (yeast)
- U3 small nucleolar RNA-associated protein 15 homolog
- UTP15, U3 small nucleolar ribonucleoprotein, homolog (S. cerevisiae)
Background
Utp15 is involved in nucleolar processing of pre-18S ribosomal.