WT1 Antibody (3B12) Summary
| Immunogen |
WT1 (NP_000369.3, 349 a.a. – 439 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTC
|
| Specificity |
WT1 (3B12)
|
| Isotype |
IgG2a Kappa
|
| Clonality |
Monoclonal
|
| Host |
Mouse
|
| Gene |
WT1
|
| Purity |
IgG purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.4)
|
| Preservative |
No Preservative
|
| Purity |
IgG purified
|
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for WT1 Antibody (3B12)
- AWT1
- GUD
- NPHS4GUD
- WAGR
- Wilms tumor 1
- Wilms tumor protein
- WIT-2
- WT1
- WT33
Background
This gene encodes a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is mutated in a small subset of patients with Wilms tumors. Multiple transcript variants, resulting from alternative splicing at two coding exons, have been well characterized. There is also evidence for the use of non-AUG (CUG) translation initiation site upstream of, and in-frame with the first AUG, leading to additional isoforms. Authors of PMID:7926762 also provide evidence that WT1 mRNA undergoes RNA editing in human and rat, and that this process is tissue-restricted and developmentally regulated.