Product: K-7174 (dihydrochloride)
XPE/DDB2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to DDB2 (damage-specific DNA binding protein 2, 48kDa) The peptide sequence was selected from the C terminal of DDB2.Peptide sequence IVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEF.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
DDB2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against DDB2 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for XPE/DDB2 Antibody
- damage-specific DNA binding protein 2 (48kD)
- damage-specific DNA binding protein 2, 48kDa
- Damage-specific DNA-binding protein 2
- DDB p48 subunit
- DDB2
- DDBB
- DNA damage-binding protein 2
- FLJ34321
- UV-damaged DNA-binding protein 2
- UV-DDB 2
- UV-DDB2
- xeroderma pigmentosum group E protein
- XP5
- XPE/DDB2
Background
This gene encodes a protein that is necessary for the repair of ultraviolet light-damaged DNA. This protein is the smaller subunit of a heterodimeric protein complex that participates in nucleotide excision repair, and this complex mediates the ubiquitylation of histones H3 and H4, which facilitates the cellular response to DNA damage. This subunit appears to be required for DNA binding. Mutations in this gene cause xeroderma pigmentosum complementation group E, a recessive disease that is characterized by an increased sensitivity to UV light and a high predisposition for skin cancer development, in some cases accompanied by neurological abnormalities.