YIF1B Antibody Summary
| Immunogen |
Synthetic peptides corresponding to YIF1B(Yip1 interacting factor homolog B (S. cerevisiae)) The peptide sequence was selected from the middle region of YIF1B.Peptide sequence LGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVA.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
YIF1B
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against YIF1B and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for YIF1B Antibody
- FinGER8
- FLJ23477
- FLJ50074
- MGC39135
- protein YIF1B
- Yip1 interacting factor homolog B (S. cerevisiae)
- YIP1-interacting factor homolog B
Background
YIF1B belongs to the YIF1 family. It is a multi-pass membrane protein. The functions of YIF1B remain unknown.