ZDHHC19 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to ZDHHC19(zinc finger, DHHC-type containing 19) The peptide sequence was selected from the N terminal of ZDHHC19.Peptide sequence TLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCR.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
ZDHHC19
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against ZDHHC19 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for ZDHHC19 Antibody
- DHHC domain containing 19
- DHHC19
- EC 2.3.1.-
- zinc finger, DHHC-type containing 19
Background
ZDHHC19 belongs to the DHHC palmitoyltransferase family. It contains 1 DHHC-type zinc finger. ZDHHC19 is a multi-pass membrane protein. The function of the ZDHHC19 protein is not known.