ZFYVE27 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to ZFYVE27(zinc finger, FYVE domain containing 27) The peptide sequence was selected from the middle region of ZFYVE27.Peptide sequence VGGKDGLMDSTPALTPTESLSSQDLTPGSVEEAEEAEPDEEFKDAIEETH.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
ZFYVE27
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against ZFYVE27 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for ZFYVE27 Antibody
- FLJ32919
- PROTRUDIN
- RP11-459F3.2
- SPG33
- zinc finger FYVE domain-containing protein 27
- zinc finger, FYVE domain containing 27
Background
ZFYVE27 may be associated with the neuronal intracellular trafficking in the corticospinal tract, which is consistent with the pathology of HSP.