Month: August 2017

Product: Estradiol (benzoate) Osteocalcin Antibody (2H9F11F8) Summary Immunogen Recombinant human osteocalcin...

Product: Urethane Osteocalcin Antibody (2H9F11F8) Summary Immunogen Recombinant human osteocalcin protein Specificity This product...

Product: Dehydroacetic acid PAR4 Antibody Summary Immunogen A synthetic peptide derived from the C-terminal...

Product: Flufenamic acid Applications/Dilutions Application Notes To start, press the tip of the pen...

Product: Anethole (trithione) p130 Antibody (130P215) Summary Immunogen Synthetic peptide: QCPELMMDRHLDQLLMCAIYVMAKVTKEDKSFQNIM, corresponding to amino...

Product: Octinoxate GFAP Antibody (6F2) Summary Immunogen Glial fibrillary acidic protein from human brain....

Product: Cefuroxime (sodium) TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody Summary Immunogen Synthetic peptide:...

Product: 8-Acetamidohexanoic acid POLR2C Antibody Summary Immunogen This POLR2C antibody is generated from rabbits...

Product: Docusate (Sodium) EPM2AIP1 Antibody Summary Immunogen This EPM2AIP1 antibody is generated from rabbits...

Product: Trihexyphenidyl (hydrochloride) KHDRBS2 Antibody Summary Immunogen This KHDRBS2 antibody is generated from rabbits...