Share this post on:

Name :
CCL13 (Human) Recombinant Protein

Biological Activity :
Human CCL13 (Q99616, 1 a.a. – 98 a.a.) full-length recombinant protein. expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins,Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

Tag :

Protein Accession No. :
Q99616

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=6357

Amino Acid Sequence :
MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT

Molecular Weight :
9

Storage and Stability :
Store at -20°C on dry atmosphere for 2 years.After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :
Ion exchange column and HPLC reverse phase column

Quality Control Testing :

Storage Buffer :
Lyophilized from 20 mM PB, 100mM NaCl, pH 7.5

Applications :
Functional Study, SDS-PAGE,

Gene Name :
CCL13

Gene Alias :
CKb10, MCP-4, MGC17134, NCC-1, NCC1, SCYA13, SCYL1

Gene Description :
chemokine (C-C motif) ligand 13

Gene Summary :
This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis. [provided by RefSeq

Other Designations :
CK-beta-10|monocyte chemoattractant protein 4|monocyte chemotactic protein 4|new CC chemokine 1|small inducible cytokine A13|small inducible cytokine subfamily A (Cys-Cys), member 13

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-12 site
MMP-9 Recombinant Proteins
Popular categories:
Serpin B4
BMP-8a

Share this post on:

Author: premierroofingandsidinginc