Name :
Mif (Mouse) Recombinant Protein
Biological Activity :
Mouse Mif (P34884) recombinant protein expressed in E.Coli.
Tag :
Protein Accession No. :
P34884
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=17319
Amino Acid Sequence :
MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
Molecular Weight :
12.5
Storage and Stability :
Stored at -20°C to-80°C for 12 month.After reconstitution with sterile water at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.Aliquot to avoid repeated freezing and thawing.The product works best when used fresh after reconstitution.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Purification :
Quality Control Testing :
Reducing and Non-Reducing SDS PAGE
Storage Buffer :
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5.
Applications :
Western Blot，
Gene Name :
Mif
Gene Alias :
GIF, Glif, MGC107654
Gene Description :
macrophage migration inhibitory factor
Gene Summary :
Other Designations :
–
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CC Chemokines Recombinant Proteins
MMP-9 site
Popular categories:
Growth Differentiation Factor 7 (GDF-7/BMP-12)
Progesterone Receptor
