Name :
NME2 (Human) Recombinant Protein
Biological Activity :
Human NME2 (P22392, 1 a.a. – 152 a.a.) full length recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins,Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Protein Accession No. :
P22392
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=4831
Amino Acid Sequence :
MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Molecular Weight :
17.2
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer :
In 20mM Tris-HCl pH 8.0 (10% glycerol, 1 mM DTT)
Applications :
Functional Study， SDS-PAGE，
Gene Name :
NME2
Gene Alias :
MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf
Gene Description :
non-metastatic cells 2, protein (NM23B) expressed in
Gene Summary :
Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of ‘A’ (encoded by NME1) and ‘B’ (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq
Other Designations :
NDP kinase B|OTTHUMP00000174727|OTTHUMP00000174728|OTTHUMP00000174774|OTTHUMP00000174775|OTTHUMP00000174776|c-myc transcription factor|non-metastatic cells 2, protein (NM23) expressed in
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-1 beta Proteinweb
Neuregulins medchemexpress
Popular categories:
CD49c/Integrin alpha-3
AKT Serine/Threonine Kinase 1 (AKT1)
