Name :
ADIPOQ (Human) Recombinant Protein,glycosilated, HMW Rich
Biological Activity :
Human ADIPOQ (Q15848, 19 a.a. – 244 a.a.) partial-length recombinant protein expressed in HEK293 cells.Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant Proteins,HuPro
Tag :
Protein Accession No. :
Q15848
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=9370
Amino Acid Sequence :
ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN.
Molecular Weight :
24.6
Storage and Stability :
Store at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time.
Host :
Human
Interspecies Antigen Sequence :
Preparation Method :
HEK 293T cell expression system
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from 20mM Tris, 50mM NaCl, pH 7.5 and 1mM CaCl2.
Applications :
SDS-PAGE，
Gene Name :
ADIPOQ
Gene Alias :
ACDC, ACRP30, ADPN, APM-1, APM1, GBP28, adiponectin
Gene Description :
adiponectin, C1q and collagen domain containing
Gene Summary :
This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. [provided by RefSeq
Other Designations :
adipocyte, C1q and collagen domain containing|adipocyte, C1q and collagen domain-containing|adiponectin|adipose most abundant gene transcript 1|gelatin-binding protein 28
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
EGF ProteinSource
GDNF Proteinmanufacturer
Popular categories:
VIP receptor type 1
Eotaxin-3/CCL26
