Name :
KCNA1 (Human) Recombinant Protein
Biological Activity :
Human KCNA1 (P21741) recombinant protein with His tag at N-Terminus expressed in Escherichia coli.
Tag :
Protein Accession No. :
P21741
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3736
Amino Acid Sequence :
MKHHHHHHHMKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD.
Molecular Weight :
14.6
Storage and Stability :
Store at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from 0.1M NaCl, pH 7.2.
Applications :
SDS-PAGE，
Gene Name :
KCNA1
Gene Alias :
AEMK, EA1, HBK1, HUK1, KV1.1, MBK1, MGC126782, MGC138385, MK1, RBK1
Gene Description :
potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)
Gene Summary :
This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK). [provided by RefSeq
Other Designations :
potassium voltage-gated channel subfamily A member 1|voltage-gated potassium channel subunit Kv1.1
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-23 Receptor Recombinant Proteins
NT-4 ProteinFormulation
Popular categories:
Cyclin-Dependent Kinase 4 Inhibitor D
Flk-1/CD309
