Name :
CD83 (Human) Recombinant Protein
Biological Activity :
Human CD83 (Q01151, 20 a.a. – 144 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.
Tag :
Protein Accession No. :
Q01151
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=9308
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGSTPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAE.
Molecular Weight :
16
Storage and Stability :
Store at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
20mM Tris-HCl buffer (pH 8.0), 0.15M NaCl and 30% glycerol.
Applications :
SDS-PAGE，
Gene Name :
CD83
Gene Alias :
BL11, HB15
Gene Description :
CD83 molecule
Gene Summary :
immunoglobulin superfamily)|OTTHUMP00000016057|cell-surface glycoprotein
Other Designations :
CD83 antigen|CD83 antigen (activated B lymphocytes, immunoglobulin superfamily)|OTTHUMP00000016057|cell-surface glycoprotein
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IFN-gamma Proteincustom synthesis
MCP-1/CCL2 ProteinMedChemExpress
Popular categories:
Alpha-1 Antitrypsin 1-3
Flt-3
