Share this post on:

Name :
ULBP1 (Human) Recombinant Protein

Biological Activity :
Human ULBP1 partial recombinant proteind with hIgG-His tag in C-terminus expressed in Baculovirus cells.

Tag :

Protein Accession No. :
Q9BZM6

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=80329

Amino Acid Sequence :
ADLGWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGHHHHHH

Molecular Weight :
23.4

Storage and Stability :
Store at 4°C for one weeks and should be stored at -20°C to -80°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze/thaw cycles.

Host :
Viruses

Interspecies Antigen Sequence :

Preparation Method :
Baculovirus expression system

Purification :
chromatographic

Quality Control Testing :

Storage Buffer :
Solution (0.5 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.

Applications :
SDS-PAGE,

Gene Name :
ULBP1

Gene Alias :
RAET1I

Gene Description :
UL16 binding protein 1

Gene Summary :

Other Designations :
OTTHUMP00000017410|alcan-beta

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Factor H web
Natriuretic Peptides B (NPPB) Recombinant Proteins
Popular categories:
Intercellular Adhesion Molecule 5 (ICAM-5)
Janus Kinase 3

Share this post on:

Author: premierroofingandsidinginc